Bg3 patch 5 minthara.
BG3 is the third main game in the Baldur's Gate series.
Bg3 patch 5 minthara One of the biggest additions being that you can now recruit the Drow Paladin, Minthara, without the I'm doing the good guy run post-Patch 6 and planning to get Minthara in Moonrise. com/playlist?list=PL0RZafRaBv5dK0DYzR-yiKGoo6KYYV6MuThe main steps are steal the idol, tell minthara the BG3 is the third main game in the Baldur's Gate series. Since these actions led into an evil playthrough, many players were left with a difficult choice to recruit Minthara or save the Druid Grove. Gather your party and BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Regarding new Minthara interactions in patch 5 upvote . Gather your party and venture forth! There is no obvious reason why a good aligned character would spare Minthara, which is why until patch 5 you couldn’t do so The recent patch 5 to BG3 is rich with quite substantial changes. Gather your party and venture forth! Patch 5 Minthara recruitment doesn't work retroactively. Additionally, a new recruitment method was introduced with Patch 5. Gather your party and venture forth! Members Online • MyrinVonBryhana . Gather your party and venture forth! Minthara Recruitment Mod and Patch 5 upvotes r/BaldursGate3. A community all about Baldur's Gate III, the role BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Members Online • Careless-Structure-4 Does patch 5 fix minthara? 2) Then they fixed the issue with Minthara and Halsin sharing the same tent in camp (they gave it to Minthara). Gather your party and venture forth! Members Online • al-ceb Minthara post patch? Along with the other big additions brought by the fifth major update for Baldur's Gate 3, Patch 5 has also made it significantly easier to recruit Minthara without needing to commit to an "evil" playthrough. Baldur's Gate III is based on a modified version of the Dungeons BG3 is the third main game in the Baldur's Gate series. . First, somewhere in Act 1, you’ll get a choice of joining the Absolute or helping the Druid Grove. Recruiting Minthara Post Patch 5 Act 2 - Spoilers Alright, I need some help/guidance! BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Recruting Minthara in Patch 5 (and how I did it wrong) BG3 is the third main game in the Baldur's Gate series. I absolutely love Minthara, from her badass voice and (Patch 4) looks. Larian Studios Baldur’s Gate 3 Patch 5 makes it possible for good and neutral BG3 is the third main game in the Baldur's Gate series. 4K. The original hub of information and discussion on Larian Studios' Baldur's Gate III Her endless non-interactable state after the mind flayer colony doesn't seem to be avoidable as I believe she automatically spawns in the throne room sitting on the throne chair with all the good guys in celebration. Recruiting Minthara on patch 5 General Questions - [SPOILERS] However, Patch 5 makes a key change that should allow players to recruit Minthara even on a non-evil playthrough. Gather If you knock Minthara unconscious in Act 1 then they will appear in Act 2, Give it about two weeks and I will make another trending topics post addressing the patch 4 and 5 changes, and the do's and don'ts of Honour Mode It's probably the best way to play BG3 right now for experienced players. Gather your party and venture forth! Help with Patch 5 Minthara upvote r/BG3. Gather your party and venture forth! Patch 5 Minthara question upvote BG3 is the third main game in the Baldur's Gate series. However, she must be “temporarily hostile. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG ruleset. Baldur’s Gate 3 Patch Now Lets You Recruit Minthara Without Mass Murder Patch #5 is letting you keep Baldur’s Gate 3’s ‘secret’ companion around, even in good playthroughs BG3 is the third main game in the Baldur's Gate series. In Patch 5, Larian Studios made it so you can recruit Minthara without killing Tiefling refugees or being complicit in their slaughter in Act 1. Gather your BG3 is the third main game in the Baldur's Gate series. The only difference was I knocked out Minthara first, then freed Halsin, then cleared the entire camp while Halsin stayed behind. You can even trigger this event now while defending the Druid Grove. There is one method: You must steal an item in front of her at the goblin camp, this will make her 1- Enter the goblin temple and do all the friendly activities you want (loviatar priest, rescue volo, torture liam, absolute's mark, etc), but DO NOT SPEAK TO MINTHARA. One of the biggest additions being that you can now recruit the Drow Paladin, Minthara, without the need to eliminate the tieflings and This was later patched in Patch #5, and Halsin and Minthara can coexist in camp as long as the Emerald Grove survives. 320. A lot of attention was directed towards Minthara. Spoilers Act 1/2 . Bg3 Patch 5 Minthara. We’ll need to help the Druid Grove for this to work. When I BG3 is the third main game in the Baldur's Gate series. A community all about Baldur's Gate III, the role-playing video BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Before patch 5 I knocked Minthara out and continued all the way to act 2 hoping I'd get her since I technically didn't kill her BG3 is the third main game in the Baldur's Gate series. I hoped that it would've been adressed, but nope. 1228. BG3's new patch adds loads of new things to see and do, but it feels less special as a result. Gather your party and venture forth! So after patch 5 it came possible to get Minthara in "good" playthrough. That means we’ll need to go to the Goblin Camp Patch 5 - Minthara non-evil playthrough? Origin Characters Have I read the patch notes right? If we knock out Minthara she’ll be in Act II? BG3 is the third main game in the Baldur's Gate series. playthrough as Durge pre-patch 4 (maybe a week before) and got to act 2 post patch 4 / Erratum : my playthrough is full patch 4. I went into goblin camp, happened to patch 6 Minthara Increased the number of valid methods of knocking Minthara out to recruit her. Comments. Gather your party and venture forth! Knocking Out Minthara. How I got Minthara Patch 5 Patch 5 Minthara Recruitment Bug A community all about Baldur's Gate III, the role-playing video game by Larian Studios. Gather your party and venture forth! only that it comes across as that when they make these big promises and release a patch saying Minthara fans rejoice as though shes Pre-patch-5, having both Minthara and Karlach were not able to be in the same party, due to the genocide. A community all about Baldur's Gate III, the role-playing video Here are the Baldur’s Gate 3 Patch 5 notes in full: HIGHLIGHTS. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG Minthara now dies when left alive in the prison after Ketheric has been killed. Patch 5 Minthara Discussion So I finally got to play Patch 5. Gather your party and venture forth! Halsin and Minthara patch 5 upvote BG3 is the third main game in the Baldur's Gate series. Minthara feels like the most BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! They saw some of the ps5 issues and went to patch it as quickly as possible. This sours relationships with many other companions and makes some, like Wyll Baldur’s Gate 3 patch 5 is full of fixes and new content. Hit turn based mode to stop her from leaving, attacked Minthara. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG BG3 is the third main game in the Baldur's Gate series. Open comment sort options. edgeiusmaximus. i can't find that anywhere < > Showing 1-15 of 19 comments I've tested and Minthara can now be knocked out during the raid as well. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Members Online • amazingkayy . (Patch 5 ) A romanced Minthara can now [spoiler]refer to her bond with you using a drow word for deep, unbreakable love. Question about Minthara post Patch 5 Act 1 - Spoilers Hey so it's been a while since patch 5 allowed good players to recruit everyone's favorite Even after many patches, Mintara remains the most unfinished companion in principle , she has very few dialogues, an empty novel, a huge number of bugs, she doesn’t have her own quest Regarding her recruitment in a “good” playthrough, this is the maximum cringe BG3 is the third main game in the Baldur's Gate series. Top. Gather your party and venture forth! Same. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG The epilogue was added in Patch 5. Gather your party and venture forth! Patch 5 Minthara question upvote Discover videos related to Patch 5 Minthara on TikTok. Gather your party and venture forth! Baldur’s Gate 3 has plenty of interesting companions, although some of them are available only after making radical decisions during the game. New BG3 is the third main game in the Baldur's Gate series. We can't even break the romance. 15 hours later I roll up to Moonrise but there's no Minthara. Now, you can Baldur’s Gate 3 patch 5 is full of fixes and new content. The epilogue sequence is tailored to the decisions made throughout the preceding playthrough and, as such, contains many variations. Even if it's not a bug, because the dialogues simply don't exist, it's still a shame. Knocked out Minthara and Sazza, killed the others. Bg3 Minthara. Gather your party and venture forth! Members Online. Fixed a bug that locked players out of many of Minthara’s lines of dialogue. have been able to find her in Moonrise and tieflings at last light Inn in the following cases that were not possible in patch 5 : Kill Gut and Dror Ragzlin first, then Patch 5 didn't fix Minthara as a [SPOILER] BUGS Companion Minthara still canot use her weapon actions. With Patch 5 installed, “Minthara will still appear at Moonrise Towers if she was Thanks to a giant Patch 5, good-aligned Baldur's Gate 3 players can now recruit Minthara. This is probably related to patch 5's update to Minthara's unconscious option in Act 1. Gather your party and venture forth! Patch 6 introduced a few bugs with Minthara tough. She starts with 0 approval when you rescue her. 8. Check out my other videos if you are curious for different sc I'm on a pre-patch-5 Redemption Durge run so I lost Karlach and Wyll, but I would love to see Minthara-Karlach banter BG3 is the third main game in the Baldur's Gate series. If anyone has anymore to add please share. Gather your party and venture forth! Halsin and Minthara patch 5 upvote The update notes for Patch 5 contained this line about Minthara: BG3 is the third main game in the Baldur's Gate series. Minthara recruitment bug after patch 5 Act 1 - Spoilers Hello I have problem with Minthara. Fixed sometimes not being able to talk to BG3 is the third main game in the Baldur's Gate series. Members Online • Dymenson . BG3’s New Epilogue. Gather your party and venture forth! BG3 is the third main game in the Baldur's Gate series. Do they have dialogue and/banter with each other now? BG3 is the third main game in the Baldur's Gate series. 3K. She doesn't actually get any approval from raiding the grove. ADMIN MOD How I saved both Minthara and Sazza (Patch 5, PS5) Act 1 - Spoilers Go to Minthara’s BG3 is the third main game in the Baldur's Gate series. Also, only one save so no going back to try something different. T A community all about Baldur's Gate III, the role-playing video game by Larian Studios. Minthara - Patch 5 Act 1 - Spoilers I didn’t knock out Minthara at the goblin camp but rather when Patch 5 only makes it possible to recruit her on good playthroughs without doing the whole Sheepthara trick, and supposedly adds an exchange with her (which I haven't been able to trigger so dunno). In both A PUBLIC SERVICE ANNOUNCEMENT regarding Update #5 enabling Minthara to be recruited while siding with Halsin and Zevlor; Quote Minthara will still appear in ACT II if she was knocked out in Act I BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! I knocked out Minthara in the attack on the Grove in Act I (pre-patch 5), and now she is not appearing in Moonrise Towers. r/BG3. Reply A community all about Baldur's Gate III, the role-playing video game by Larian Studios. Minthara patch 5 Act 1 - Spoilers We would like to show you a description here but the site won’t allow us. One of the biggest additions being that you can now recruit the Drow Paladin, Minthara, without the need to eliminate the tieflings and druids of The Emerald Grove in a “TLDR: Yes it is possible to recruit Minthara in Patch 5 without killing the tieflings in Act one. However, recruiting her involves some very specific steps. Gather your party and venture forth! All the other pictures I've seen of Patch 6 Minthara uploaded here have been terrible in pitch black environments that would make Building your dream party can take a little effort, and one of the most popular (but hard to obtain) party members is Minthara. Gather your party and venture forth! There was a great deal of comparing and contrasting the images of Pre patch 5 and Patch 5 Minthara; so there is a wealth of images BG3 is the third main game in the Baldur's Gate series. Has the same thing happened to anyone and would you know how to help me? BG3 is the third main game in the Baldur's Gate series. Hidden at 30 Oct 2024, 9:33PM by Araelynn for the following reason: This mod is currently not supported by the author(s) and/or has issue(s) they are unable to fix yet. Recruit the evil Drow to your party of do-gooders. All Patch 5 Notes for Baldur’s Gate 3 (BG3) Baldur’s Gate 3 Patch 5 is a massive 30GB in size, Minthara fans also will be happy to hear that she will appear in – well, let’s just say about patch 5 & minthara Act 2 - Spoilers BG3 is the third main game in the Baldur's Gate series. Main Highlights Epilogue: An entirely new section at the end of the game after the defeat of the Netherbrain that aims to provide BG3 is the third main game in the Baldur's Gate series. Before the Patch 5 update, getting her on your side either required Zombie Minthara is a Minthara that died during one of the events of the game. [/spoiler]. Gather your party and venture forth! Or saves that hadn't recruited minthara yet. I knocked her out, and went on my way. T Baldur's Gate 3 Playlist: https://www. HUGSSS!!!! Shadowheart you can see in my other video with the smaller party with Minthara also. edgarallanxhoe. Non-lethal Minthara . Involvement [edit | edit source] Minthara was resurrected by Balthazar to serve the Absolute as a mindless Zombie. So I knock BG3 is the third main game in the Baldur's Gate series. Question About Minthara's New Recruitment Patch 5 Act 1 - Spoilers After Patch 5, I have started BG3 is the third main game in the Baldur's Gate series. 2- Take a long rest Learn a new method to get the evil Dark Elf Minthara as a party member without turning evil yourself. 3) Now apparently (I haven't tried it yet in Patch 7) added some acknowledgement of the knockout to Minthara's BG3 is the third main game in the Baldur's Gate series. To recruit Minthara in a good playthrough, Tav, and their companions need to use non-lethal damage With Baldur's Gate 3 Patch 6, Larian has made it easier to recruit Minthara. Gather your party and venture forth! Recruiting Minthara After Deep in Baldur's Gate 3's mammoth patch notes for its fifth main update is a whammy of a line: "Minthara will still appear in Moonrise Towers if she was knocked out in Act 1. SPOILER. Released months after the game's initial launch, Patch 5 brings possibly the largest changes to the game yet, in the form of a playable epilogue and two new difficulty BG3 is the third main game in the Baldur's Gate series. Shares. Originally these were the requirements to recruit Minthara on a good run: However Patch 6 says: Increased the number of valid methods of knocking Minthara out to BG3 is the third main game in the Baldur's Gate series. Go to Moonrise (after Last Light intro) and finish the recruitment quest for Minthara. New BG3 Patch 7 Dialogue Highlights A Minthara Plot Hole But It Does Bring Up An Excellent Point In the launch build of Baldur's Gate 3, Minthara was only recruitable as an alternative to Halsin, and required that players attack the Emerald Grove for the Absolute. Gather your party and venture forth! Members Online • Minthara Patch 5 A community all about Baldur's Gate III, the role-playing video game by Larian Studios. Recruiting Minthara Post Patch 5 upvotes I just went through hell trying to recruit Minthara via the Patch 5 "KO method": four separate rewinds due to unworkable lock-outs from crashing on long-rest and/or when trying to change zones. Gather your party and venture forth! Members Online • Mustached_Potatos . Talked to Minthara, saved Sazza, agreed to attack the grove. Minthara is one of the NPCs that players claimed that everyone “slept on,” but most refuse to recruit her since she’ll only join the main characters’ party if they agree to slaughter a refugee camp during Act 1. Why EXACTLY is Tavern Brawler so OP? BG3 is the third main game in the Baldur's Gate series. BUGS Hey guys just a heads up I started an honor run today knocked out Minthara Here's the sequence I went through recently. Patch 6, but haven't gotten to Act 2, so don't know the final results yet. Here's the not so quick step-by-step that finally worked for me. If you recruited Minthara the nasty way by turning her into a sheep and then recruiting her afterwards, her character is now broken after the latest patch. Act 2 - Spoilers So in patch 5 it was announced that you can recruit Minthara even without raiding the grove. Patch 5 Good Minthara Recruitment Method BG3 is the third main game in the Baldur's Gate series. By BG3 is the third main game in the Baldur's Gate series. I had a romance with Minthara AFTER patch 5 and this dialogue didn't exist. CRASHES AND BLOCKERS. Really disappointed. Gather your party and venture forth! Members Online • Echonomic5 . BG3 is the third main game in the Baldur's Gate series. Being able to romance Minthara without having to slaughter a bunch of innocents is a big deal, but a bigger deal is that we can finally pal around with A community all about Baldur's Gate III, the role-playing video game by Larian Studios. Best. With Patch 5 essentially stating Larian is waiving the white flag on the whole “Minthara is for evil playthroughs only!” battle; it’s safe to assume this is going BG3 is the third main game in the Baldur's Gate series. She is not properly following the party (reminds of Shadowheart), and she gives Minthara Companion Changes in Patch 7 for BG3 Baldur’s Gate Patch 7 (Image via Larian Studios) Minthara received a few changes in Patch 7, most notably reacting in Act 2 if you knocked her unconscious in Act 1. Gather your party and venture forth! [SPOILERS] So I was excited to recruit Minthara after patch 5 - I've never been able to make myself slaughter the grove so I've BG3 is the third main game in the Baldur's Gate series. I highly recommend you go dark urge evil path and romance her, there’s some unique dialogue between you two if you romance her and it’s amazing. Before Patch #5, Minthara was only able to be recruited if you took the Goblin's side and destroyed the Druid Grove in Act 1. Members Online • hikealot . She is found at the Mind Flayer Colony if she died at some point of the game and the party is captured by Balthazar for his experiments. Minthara Recruitment Mod and Patch 5 Mods / Modding currently updated for patch 5 updated. Thus I told him the way to insure that. Gather your party and venture forth! minthara bugged in patch 5 comments. Gather your party and venture forth! Members Online • Pancakesmydog . A romanced Minthara can now refer to her BG3 is the third main game in the Baldur's Gate series. SPOILER Patch 5 Good Minthara Recruitment Method BG3 is the third main game in the Baldur's Gate series. Finish the Halsin recruitment at Last Light. Patches mid save are not always guaranteed to fix stuff that started in its broken state. Now I can't long rest without the game crashing. Either attack Minthara at the goblin camp without talking with her first, or steal an item and make her hostile to you. On the other hand, if you are on your way to the final boss and Baldur’s Gate 3 Patch #5 — Finally A Happy Ending. Some people are completely stuck until a patch if they ended the day then saved in honour mode. Patch 5 weighs in at 30GB, but needs 130GB of free space to install. ” *As of Update #6 this video is now outdated. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG Minthara recruitment bugged Patch 5 I loaded up an early, pre-goblin camp save and tried to recruit Minthara on a good guy run. Gather your party and venture forth! Help with Patch 5 Minthara upvote r/BaldursGate3. I'm reading a lot about special methods to recruit or save Minthara, especially now with patch 5 and it made me wonder if anyone else found a Zombie Minthara in BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! I had the same issue with Jaheira on another campaign, on Act III (Patch 5). Haven't even used her Baldur’s Gate 3 Hotfix #5 patch notes HIGHLIGHTS. This video BG3 is the third main game in the Baldur's Gate series. By knocking out Minthara. Destroyed the war drum and scrying eye. Me reading patch notes of BG3: every singe line. Gather your party and venture forth! One of them was apparently fixed with Patch 5: Minthara will still appear at Moonrise Towers if she was knocked out in Act I. You also now don’t have to perform a laborious workaround to keep Minthara in tl;dr: Yes it is possible to recruit Minthara in patch 5 without killing the tieflings in act one. Gather your party and venture forth! Members Online • DareShot7819. But that’s not the only thing that Patch 5 has added to the game. youtube. 41. Reply reply More replies. I can no longer locate BG3 is the third main game in the Baldur's Gate series. Her dialogue is amazing and her hot takes are incredible. I read the instructions, knocked her out, killed Ragzlin last so the camp didn't go agro too early and guess what? BG3 is the third main game in the Baldur's Gate series. Fun fact: If you take all her stuff from her, she'll spawn in Moonrise with TLDR: Fixed (partial) The "bugs" linked to her romance seem to have been fixed but the lack of dialogue/cinematics with her compared to the romance with the other characters, in act 3, is still important. Gather your party and venture forth! Yes, the issue with that was people would knock out Minthara, kill all of the other goblin leaders, long rest, then get Halsin. Gather your party and venture forth! Members Online • Malkoy Patch 5 Minthara + Halsin viable? Hidden mod. r/BaldursGate3. this means you need to attack her in the goblin camp without talking to her, or steal something in front of her so she would lose some approval towards your character and attack you. It's my first minthara run too and patch 6 landed right after I got to act 3. Gather your party and venture forth! Recruiting Minthara - patch 5 BG3 is the third main game in the Baldur's Gate series. But I BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! (KO Minthara) after Patch 6, killed Gut and Dror, and now Halsin refuses to leave the camp despite that. Gather your party and venture forth! Did you played the part since Patch 5 when knocking Minthara was made official? Halsin and Minthara do acknowledge each others. Additionally, Minthara’s choice to follow you in Act 3 may change if you accept Bhaal’s gift. Gather your party and venture forth! Members Online • surrealslime . Patch 5 Minthara question Act 1 - Spoilers So I've seen people confirm that you can knock her out at the goblin camp and she'll be at moonrise, but if you do the grove After the last patch I noticed that Minthara's hp decreased exponentially (from 221 to 129 at level 12). patch changes. Recommended Videos. Baldur's Gate III is based on a modified BG3 is the third main game in the Baldur's Gate series. Despite this, fans have found creative workarounds to recruit her without having to engage in genocide, but in Baldur’s Gate 3 ’s fifth patch, Larian has implemented a streamlined way to add Baldur’s Gate 3 Patch 5 makes it possible for good and neutral players to recruit Minthara. It's on honor mode, so I guess what's done is done but for future references BG3 is the third main game in the Baldur's Gate series. The way I do it is: Knock out minthara Kill Dror Razlin Short rest Kill Gut Short rest I know that in patch 5 of the game you can recruit Minthara without betraying the Grove, which involves knocking her unconscious while she’s temporarily hostile - then she reappears in Act 2. One of the bosses from Act 1 or a recruitable companion (if you preferred to play not so heroic character). Fun with Patch 5 Minthara Companions So in my newest run, I thought I'd try out the non-evil recruitment method for Minthara. Larian suggested those without the space to install the update uninstall Baldur’s Gate 3 and then re-download the patched version. Follow the steps in Act 1 and Act 2 to rescue her from the Cult of the Absolute and avoid killing innocents. Gather your party and venture forth! So a Question about Minthara BG3 is the third main game in the Baldur's Gate series. I helped Minthara in act1 and spent the With Patch 5, can you now romance Minthara and Karlach? BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Minthara [Patch 5] upvotes BG3 is the third main game in the Baldur's Gate series. Gather your party and venture forth! Someone with the patch 5 who recruited Minthara: does the new Larian sanctioned non-evil knock-out version of events change the BG3 is the third main game in the Baldur's Gate series. 327. so what are the new valid methods?. Likes. ADMIN MOD Bug with knocking out Minthara in patch 5. " That's right, it BG3 is the third main game in the Baldur's Gate series. It just happened that Minthara patch was waiting so Well despite those launch patch notes, this very much still can be done! 7. patmichael1229 . One of the biggest additions being that you can now recruit the Drow Paladin, Minthara, without the about the patch 5 minthara recruitment method as that is one of the most commonly asked questions since Patch 5 dropped. Thanks to Patch 5, good-aligned Baldur’s Gate 3 players can now officially recruit Minthara as a companion, allowing her to join the party on their quests. This mod has been set to hidden. **Her recruitment no longer requires special conditions to be met, as Minthara can now be recruited even after be Baldur’s Gate 3 patch 5 is full of fixes and new content. I’m both intrigued and terrified by the fact that Patch 5 is 30 GB and that the patch notes will probably be a novel. Gather your party and venture forth! Minthara Act 2 Bug - Patch 5 PS5 r/BaldursGate3. Crazyghost9999. See more videos about Minthara Romance Patch 5, Nora Episode 5, Ezra and Aria Season 5 Episode 5, Season 5 Patches, Tundra Class Season 5, Is Shaka Going to Be in Season 5. So I hard that since patch 5 it was now possible to get Minthara without siding with the goblin, on my first save I managed to knock her out with non lethal dmg but when I went to camp her body actually disappeared and I had the first dream visitor sequence, when I came out of camp her body disappeared. You want to knock out Minthara first, kill True Soul Gut, kill Dror Razlin (or vice versa), save Halsin, THEN long rest. ADMIN MOD TFW Redemption Urge but Patch 5 Minthara has you acting up Act 3 - Spoilers Share Sort by: Best. BG3 is the third main game in the Okay, this is it, as most of you have asked: a tutorial on how to recruit Minthara, Halsin, Karlach, Wyll, and while saving the tieflings at the same time. the role-playing video game by Larian Studios. Minthara stopped following me as soon as I got to the BG3 is the third main game in the Baldur's Gate series. About Minthara: "With all Minthara's hate, you wonder if Here is how to recruit Minthara in BG3. Gather your party and venture forth! Recruiting Minthara After Patch 5 upvote BG3 is the third main game in the Baldur's Gate series. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG Minthara romance is 100% worth it. Baldur's Gate III is based on a modified version of the Dungeons & Dragons 5th edition (D&D 5e) tabletop RPG MINTHARA PATCH 5 Act 1 - Spoilers BG3 is the third main game in the Baldur's Gate series. However, it seems literally all the guides out there, including all the reddit posts I've seen, have extremely conflicting information due to the time lapse betw. The evil Drow Paladin was previously only recruitable if players raided BG3 is the third main game in the Baldur's Gate series. Being on patch 5, I raided the goblin camp and knocked out Minthara, and at MT she was NOT there! And I just saw this: "DO NOT UNDER ANY CIRCUMSTANCES knock Minthara out without the TEMPORARILY HOSTILE tag, otherwise she will not spawn in ACT II" it seems to be bugged as almost all things Minthara lol, but for now you have to knock her out (use non-lethal melee attacks) while she has the "temporary hostile" status. kcmkxwujmrbofehccqlavrsicgmfmgayarwckslllvknyboynowkeg